HORDB

ID: hor007057
Uniprot ID: P50390??22-150)
Protein name: Transthyretin
Gene name: EPO
Organism: Sus scrofa
Family: Transthyretin family
Source: Human
Expression: Detected in plasma and cerebrospinal fluid (at protein level). Highly expressed in the choroid plexus. Detected in liver.
Disease: NA
Comments: NA
Taxonomy: Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig)
GO MF: GO:0005615 extracellular space
GO BP: GO:0005179 hormone activity; GO:0036094 small molecule binding; GO:0070324 thyroid hormone binding
GO CC: GO:0006144 purine nucleobase metabolic process; GO:0070324; F:thyroid hormone binding; IMP:AgBase.

Sequence: PAGAGESKCPLMVKVLDAVRGSPAVNVGVKVFKKAADGTWEPFALGKTSEFGELHGLTTDEKFVEGIYKVELDTKSYWKALGISPFHEYAEVVFTANDSGRRHYTIAALLSPYSYSTTALVSSPKEGAL
Length: 129
Propeptide: MASYRLLLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVNVGVKVFKKAADGTWEPFALGKTSEFGELHGLTTDEKFVEGIYKVELDTKSYWKALGISPFHEYAEVVFTANDSGRRHYTIAALLSPYSYSTTALVSSPKEGAL
Signal peptide: MASYRLLLLCLAGLVFVSEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

Mass:		Formula:
Absent amino acids:		Common amino acids:
pI:		Basic residues:
Polar residues:		Hydrophobic residues:
Hydrophobicity:		Boman Index:
Half-Life:		Half-Life Yeast:
Half-Life E.Coli:		Aliphatic Index
Instability Index:		Extinction Coefficient cystines:
Absorbance 280nm: